Multiple Sequence Alignment:
CRABP2 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       130         )
           |         |         |         |         |         |         |         |         |         |         |         |         |         
CRABP2 human MPNFSGNWkIIRsENFEELLkVLGVNVMLRkIAVAAASkPAVEIkQEGD-TFYIKTSTTVRTtEINFKVGEEFEEQTVDGRPCkSLVkWEsENKMVCEQkLLkGEGPKTSWTRELTNDGELILTMTADDVVCTRVYVRE
CRABP2 mouse MPNFSGNWKIIRSENFEEMLKALGVNMMMRkIAVAAASkPAVEIkQEND-TFYIKTSTTVRTTEINFKIGEEFEEQTVDGRPCKSLVKWESGNKMVCEQRLLKGEGPKTSWSRELTNDGELILTMTADDVVCTRVYVRE
CRABP2 rat MPNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQENDDTFYIKTSTTVRTTEINFKIGEEFEEQTVDGRPCKSLVKWESENKMVCEQRLLKGEGPKTSWSRELTNDGELILTMTADDVVCTRVYVRE
  ******************:**:****:*:******************:*.******************:**********************:*******:***********:***************************
Consensus MPNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIKQEND-TFYIKTSTTVRTTEINFKIGEEFEEQTVDGRPCKSLVKWESENKMVCEQRLLKGEGPKTSWSRELTNDGELILTMTADDVVCTRVYVRE
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.