Multiple Sequence Alignment:
MYCBP Download MSA
  (        10        20        30        40        50        60        70        80        90       100   )
           |         |         |         |         |         |         |         |         |         |   
MYCBP human MAHYkAADSKREQFRRYLEkSGVLDTLTkVLVALYEEPEkPNSALDFLKHHLGAAtPENPEIELLRLELAEMKEKYEAIVEENKKLKAkLAQYEPPQEEkRAE
MYCBP mouse MAHYKAADSKREQFRRYLEksGVLDTLTKVLVALYEEPEKPTSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEATVEENKKLKAKLVQYEPPQEEKRAE
  *****************************************:************************************:***********:************
Consensus MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.