Multiple Sequence Alignment:
APOC4 Download MSA
  (        10        20        30        40        50        60        70        80        90       100       110       120       )
           |         |         |         |         |         |         |         |         |         |         |         |       
APOC4 human MSLLRNRLQALPALCLCVLVLACIGACQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
APOC4 mouse MSLLRCRPRDLPSVSLSVLFLVSFVASMST---ESLSPTPGPESSRWSLVRARVLEMVEPLVTRTRDRWQWFWGPGAVQGFMQTYYEDHLKDLGPRTQAWLQSSRDHLLnKTHSLCPRLLCKDRTQG
APOC4 rat MSLLRCRQQTLPSLCLSVLFLACFVASMPT---ESLTPTPGPENSRWSLVRARVMEMVEPLVTRTRDRWRWFWGPRAIQGFVQTYyEDHLKDLGPRTQAWLQSSRDHLLNKTHSLCPRLLCRDWTQG
  *****:*.::**:::*:**:*::::*::::...::*:*:*:::.*******:*:.*::*::*:****:*:***:*.:.:**:****:***:****:*:**:::*:*:**:*********:*.*.:**
Consensus MSLLRCRQQALPSLCLSVLFLACFVASMPT---ESLSPTPGPENSRWSLVRARVLEMVEPLVTRTRDRWQWFWGPRAIQGFMQTYYEDHLKDLGPRTQAWLQSSRDHLLNKTHSLCPRLLCRDRTQG
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using Clustal Omega. Conservation and consensus calculated using von Neumann entropy from PFAAT.