Multiple Sequence Alignment:
MRPS36 Download MSA
  (        10        20        30        40        50        60        70        80        90       100   )
           |         |         |         |         |         |         |         |         |         |   
MRPS36 human MMGSKMASASRVVQVVkPHtPLIRFPDRRDNPkPNVSEALRSAGLPSHssVIsQHSKGSksPDLLMYQGPPDTAEIIkTLPQKYRRKLVsQEEMEFIQrGGPE
MRPS36 mouse -MGSKMASATRVVQVVKPHAPLIKFPNRRDKPKLSAsEALGSAALPSHSSAISQHSKGStsPDLLMHQGPPDTAEIIkSLPQKYRRKPMsQEEMEFIQRGGPE
  .********:*********:***:**:***:**:::****:**:******:********:******:***********:********::**************
Consensus MMGSKMASASRVVQVVKPHAPLIRFPNRRDNPKLNASEALRSAALPSHSSAISQHSKGSKSPDLLMHQGPPDTAEIIKSLPQKYRRKLMSQEEMEFIQRGGPE
Modified residues are boxed in RED. Mouse-over modified sites to view residue numbers.
Aligned using MAFFT. Conservation and consensus calculated using von Neumann entropy from PFAAT.